Recombinant Human PP1C gamma Protein
Beta LifeScience
SKU/CAT #: BLA-7206P
Recombinant Human PP1C gamma Protein
Beta LifeScience
SKU/CAT #: BLA-7206P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | P36873 |
Synonym | PP 1G PP-1G PP1C PP1G PP1G_HUMAN PP1gamma PPP 1G PPP1CC PPP1G Protein phosphatase 1, catalytic subunit, gamma isozyme Protein phosphatase 1C catalytic subunit Serine/threonine phosphatase 1 gamma Serine/threonine protein phosphatase PP1 gamma catalytic subunit Serine/threonine-protein phosphatase PP1-gamma catalytic subunit |
Description | Recombinant Human PP1C gamma Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | ADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPI LLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSL ETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKT FTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLL CDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVV EDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEK KKPNATRPVTPPRGMITKQAKK |
Molecular Weight | 37 kDa |
Purity | Greater than 95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |