Recombinant Human Polycystin 2 Protein
Beta LifeScience
SKU/CAT #: BLA-7181P
Recombinant Human Polycystin 2 Protein
Beta LifeScience
SKU/CAT #: BLA-7181P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | Q13563 |
Synonym | APKD2 Autosomal dominant polycystic kidney disease type II Autosomal dominant polycystic kidney disease type II protein MGC138466 MGC138468 PC 2 PC2 PKD 2 PKD2 PKD2_HUMAN PKD4 Polycystic kidney disease 2 Polycystic kidney disease 2 (autosomal dominant) Polycystic kidney disease 2 protein Polycystin 2 Polycystin 2 transient receptor potential cation channel Polycystin-2 Polycystin2 Polycystwin R48321 Transient receptor potential cation channel subfamily P member 2 TRPP2 |
Description | Recombinant Human Polycystin 2 Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | PVSKTEKTNFKTLSSMEDFWKFTEGSLLDGLYWKMQPSNQTEADNRSFIF YENLLLGVPRIRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGP |
Molecular Weight | 37 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |