Recombinant Human POLR3K Protein (BSA and azide free)

Beta LifeScience SKU/CAT #: BLA-7180P

Recombinant Human POLR3K Protein (BSA and azide free)

Beta LifeScience SKU/CAT #: BLA-7180P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species Human
Accession Q9Y2Y1
Synonym C11 C11 RNP3 DNA directed RNA polymerase III subunit K DNA directed RNA polymerase III subunit RPC10 DNA directed RNA polymerases III 12.5 kDa polypeptide DNA-directed RNA polymerase III subunit K DNA-directed RNA polymerase III subunit RPC10 hRPC11 HsC11p My010 POLR3K Polymerase (RNA) III (DNA directed) polypeptide K Polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa RNA polymerase III 12.5 kDa subunit RNA polymerase III subunit (hRPC11) RNA polymerase III subunit C10 RNA polymerase III subunit C11 RNA polymerase III subunit CII RPC10 RPC10_HUMAN RPC11 RPC12.5
Description Recombinant Human POLR3K Protein (BSA and azide free) was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MGSSHHHHHHSSGLVPRGSHMGSMLLFCPGCGNGLIVEEGQRCHRFACNT CPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRA YFMQLQTRSADEPMTTFYKCCNAQCGHRWRD
Molecular Weight 15 kDa including tags
Purity Greater than 85% SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway.
Subcellular Location Nucleus, nucleolus.
Protein Families Archaeal RpoM/eukaryotic RPA12/RPB9/RPC11 RNA polymerase family
Database References

Gene Functions References

  1. Results from a study on gene expression variability markers in early-stage human embryos shows that POLR3K is a putative expression variability marker for the 3-day, 8-cell embryo stage. PMID: 26288249
  2. Changes in Maf1 expression affect Pol III-dependent transcription in human glioblastoma lines. PMID: 17499043

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed