Recombinant Human POLR3K Protein (BSA and azide free)
Beta LifeScience
SKU/CAT #: BLA-7180P
Recombinant Human POLR3K Protein (BSA and azide free)
Beta LifeScience
SKU/CAT #: BLA-7180P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | Q9Y2Y1 |
Synonym | C11 C11 RNP3 DNA directed RNA polymerase III subunit K DNA directed RNA polymerase III subunit RPC10 DNA directed RNA polymerases III 12.5 kDa polypeptide DNA-directed RNA polymerase III subunit K DNA-directed RNA polymerase III subunit RPC10 hRPC11 HsC11p My010 POLR3K Polymerase (RNA) III (DNA directed) polypeptide K Polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa RNA polymerase III 12.5 kDa subunit RNA polymerase III subunit (hRPC11) RNA polymerase III subunit C10 RNA polymerase III subunit C11 RNA polymerase III subunit CII RPC10 RPC10_HUMAN RPC11 RPC12.5 |
Description | Recombinant Human POLR3K Protein (BSA and azide free) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSMLLFCPGCGNGLIVEEGQRCHRFACNT CPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRA YFMQLQTRSADEPMTTFYKCCNAQCGHRWRD |
Molecular Weight | 15 kDa including tags |
Purity | Greater than 85% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |