Recombinant Human PNPO Protein
Beta LifeScience
SKU/CAT #: BLA-7159P
Recombinant Human PNPO Protein
Beta LifeScience
SKU/CAT #: BLA-7159P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | Q9NVS9 |
Synonym | EC 1.4.3.5 FLJ10535 PDXPO PNPO PNPO_HUMAN Pyridoxal 5' phosphate synthase pyridoxamine 5' phosphate oxidase Pyridoxamine phosphate oxidase Pyridoxamine-phosphate oxidase pyridoxine 5' phosphate oxidase Pyridoxine-5'-phosphate oxidase |
Description | Recombinant Human PNPO Protein was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMDPVKQFAAWFEEAVQCPDIGEANAMCLAT CTRDGKPSARMLLLKGFGKDGFRFFTNFESRKGKELDSNPFASLVFYWEP LNRQVRVEGPVKKLPEEEAECYFHSRPKSSQIGAVVSHQSSVIPDREYLR KKNEELEQLYQDQEVPKPKSWGGYVLYPQVMEFWQGQTNRLHDRIVFRRG LPTGDSPLGPMTHRGEEDWLYERLAP |
Molecular Weight | 26 kDa including tags |
Purity | Greater than 95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycle. |