Recombinant Human PNMT Protein
Beta LifeScience
SKU/CAT #: BLA-7156P
Recombinant Human PNMT Protein
Beta LifeScience
SKU/CAT #: BLA-7156P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | P11086 |
Synonym | Noradrenaline N-methyltransferase PENT Phenylethanolamine N-methyltransferase PNMT PNMT_HUMAN PNMTase |
Description | Recombinant Human PNMT Protein was expressed in Baculovirus infected Sf9 cells. It is a Full length protein |
Source | Baculovirus infected Sf9 cells |
AA Sequence | MSGADRSPNAGAAPDSAPGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNP NGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMT DFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRAR VKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDH ITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKV RDLRTYIMPAHLQTGVDDVKGVFFAWAQKVGL |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | The specific activity ofthis protein was 170nmol/min/mg in amethyltransferase assay usingnorepinephrine as substrate. |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. |