Recombinant Human PMP2 Protein
Beta LifeScience
SKU/CAT #: BLA-7146P
Recombinant Human PMP2 Protein
Beta LifeScience
SKU/CAT #: BLA-7146P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | P02689 |
Synonym | FABP8 M FABP MP2 Myelin FABP Myelin P2 protein MYP2_HUMAN P2 Peripheral myelin protein 2 PMP2 |
Description | Recombinant Human PMP2 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MKHHHHHHASNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVI ISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSL NQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV |
Molecular Weight | 16 kDa |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -80°C. |