Recombinant Human PLGF Protein
Beta LifeScience
SKU/CAT #: BLA-7118P
Recombinant Human PLGF Protein
Beta LifeScience
SKU/CAT #: BLA-7118P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | P49763 |
Synonym | D12S1900 Pgf PGFL PIGF Placenta growth factor Placental growth factor Placental growth factor, vascular endothelial growth factor related protein PlGF PlGF 2 PLGF_HUMAN PlGF2 SHGC 10760 |
Description | Recombinant Human PLGF Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MLPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPS EVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSY VELTFSQHVRCECRHSPGRQSPDMPGDFRADAPSFLPPRRSLPMLFRMEW GCALTGSQSAVWPSSPVPEEIPRMHPGRNGKKQQRKPLREKMKPERCGDA VPRR |
Molecular Weight | 25 kDa |
Purity | >95% by SDS-PAGE . |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at Room Temperature. Upon delivery aliquot. Store at -20°C or -80°C. Working aliquots stored with a carrier protein are stable for at least 3 months at -20°C to -80°C.. |