Recombinant Human PLA2R Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-7095P
Recombinant Human PLA2R Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-7095P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | Q13018 |
Synonym | 180 kDa secretory phospholipase A2 receptor C-type lectin domain family 13 member C CLEC13C M type receptor M-type receptor Phospholipase A2 receptor 1 PLA2 R PLA2-R PLA2G1R PLA2IR PLA2R PLA2R_HUMAN PLA2R1 Soluble PLA2-R Soluble PLA2R Soluble secretory phospholipase A2 receptor |
Description | Recombinant Human PLA2R Protein (His tag) was expressed in Mammalian. It is a Protein fragment |
Source | Mammalian |
AA Sequence | EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSN KIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCE ERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID |
Molecular Weight | 169 kDa |
Purity | >90% by SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |