Recombinant Human PLA2G12B Protein
Beta LifeScience
SKU/CAT #: BLA-7087P
Recombinant Human PLA2G12B Protein
Beta LifeScience
SKU/CAT #: BLA-7087P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q9BX93 |
Synonym | 2010002E04Rik FKSG71 Group XIIB phospholipase A2 Group XIII secreted phospholipase A2 GXIIB GXIIIsPLA2 MGC138151 Phospholipase A2, group XIIB PLA2G12B PLA2G13 |
Description | Recombinant Human PLA2G12B Protein was expressed in Mammalian. It is a Full length protein |
Source | Mammalian |
AA Sequence | QSDTSPDTEESYSDWGLRHLRGSFESVNSYFDSFLELLGGKNGVCQYRCR YGKAPMPRPGYKPQEPNGCGSYFLGLKVPESMDLGIPAMTKCCNQLDVCY DTCGANKYRCDAKFRWCLHSICSDLKRSLGFVSKVEAACDSLVDTVFNTV WTLGCRPFMNSQRAACICAEEEKEEL |
Molecular Weight | 21 kDa including tags |
Purity | >= 60% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |