Recombinant Human PITPN Protein
Beta LifeScience
SKU/CAT #: BLA-7045P
Recombinant Human PITPN Protein
Beta LifeScience
SKU/CAT #: BLA-7045P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | Q00169 |
Synonym | MGC99649 Phosphatidylinositol transfer protein alpha Phosphatidylinositol transfer protein alpha isoform Phosphotidylinositol transfer protein PI-TP-alpha PIPNA_HUMAN PITP alpha Pitpna PITPNB PtdIns transfer protein alpha PtdInsTP PtdInsTP alpha Vb VIB1A Vibrator |
Description | Recombinant Human PITPN Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMVLLKEYRVILPVSVDEYQVGQLYSVAEAS KNETGGGEGVEVLVNEPYEKDGEKGQYTHKIYHLQSKVPTFVRMLAPEGA LNIHEKAWNAYPYCRTVITNEYMKEDFLIKIETWHKPDLGTQENVHKLEP EAWKHVEAVYIDIADRSQVLSKDYKAEEDPAKFKSIKTGRGPLGPNWKQE LVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQERRLFTNFHRQLFC WLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD |
Molecular Weight | 34 kDa including tags |
Purity | Greater than 95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycle. |