Recombinant Human PIP Protein (denatured)
Beta LifeScience
SKU/CAT #: BLA-7029P
Recombinant Human PIP Protein (denatured)
Beta LifeScience
SKU/CAT #: BLA-7029P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | P12273 |
Synonym | GCDFP15 GP17 Gross cystic disease fluid protein 15 Prolactin induced protein Prolactin inducible protein SABP Secretory actin binding protein |
Description | Recombinant Human PIP Protein (denatured) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSQDNTRKIIIKNFDIPKSVRPNDEVTAV LAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTN RTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE |
Molecular Weight | 16 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |