Recombinant Human PIP Protein (denatured)

Name: Recombinant Human PIP Protein (denatured)
Brand: Beta LifeScience
SKU: BLA-7029P
Availability: InStock

Collections: Other recombinant proteins, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Human
Accession	P12273
Synonym	GCDFP15 GP17 Gross cystic disease fluid protein 15 Prolactin induced protein Prolactin inducible protein SABP Secretory actin binding protein
Description	Recombinant Human PIP Protein (denatured) was expressed in E.coli. It is a Full length protein
Source	E.coli
AA Sequence	MGSSHHHHHHSSGLVPRGSHMGSQDNTRKIIIKNFDIPKSVRPNDEVTAV LAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTN RTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE
Molecular Weight	16 kDa including tags
Purity	>90% SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

Target Details

Subcellular Location	Secreted.
Protein Families	PIP family
Database References	HGNC: 8993 OMIM: 176720 KEGG: hsa:5304 STRING: 9606.ENSP00000291009 UniGene: Hs.99949
Tissue Specificity	Expressed in pathological conditions of the mammary gland and in several exocrine tissues, such as the lacrimal, salivary, and sweat glands.

Gene Functions References

Unusual N-type glycosylation of salivary prolactin-inducible protein (PIP): multiple Lewis(Y) epitopes generate highly-fucosylated glycan structures. PMID: 29858715
that GATA3 is a very sensitive marker for primary genital extramammary Paget diseases and is more sensitive than gross cystic disease fluid protein 15 PMID: 28693610
monoclonal antibodies to GATA-3 are very sensitive reagents for the identification of breast CA, surpassing antibodies to GCDFP-15 and mammaglobin A, and offer a significant improvement in identifying TNBCs PMID: 26447897
good coincidence was observed between primary and metastatic tumor GATA3 expression (kappa value = 0.826 >0.75) as compared with the coincidence of GCDFP15 (kappa value =0.492 <0.75) and mammaglobin (kappa value =0.593 <0.75) PMID: 28038704
High expression of GCDFP-15 is associated with molecular apocrine breast cancer. PMID: 26711786
While highly expressed under pathological conditions of the mammary gland, including breast cancers, PIP is expressed in very few other cancers. Although the function of PIP is not well elucidated, numerous studies suggest that its primary role may be related to host defense and immune modulation. Studies in Pip null mice suggest that PIP may play a similar immune-regulatory role in breast cancer. [Review] PMID: 27602994
novel marker GATA3 stains a significantly higher proportion of both primary and metastatic breast carcinomas than GCDFP15 or mammaglobin with stronger and more diffuse staining, helpful in cases with small tissue samples PMID: 25906123
In summary, this study suggests that PIP expression regulates the process of cell adhesion in breast cancer. PMID: 26585492
GCDFP15 in stratum corneum is a potential marker for dysregulated sweating in atopic dermatitis. PMID: 25919462
The commonly used breast carcinoma biomarkers vary in their prognostic implications. GCDFP-15 independently indicated a favourable prognosis. GATA-3 and MGB were not associated with outcome. PMID: 25425335
Data indicate the potential role of Gross cystic disease fluid protein-15/prolactin-inducible protein (GCDFP-15/PIP) as a biomarker for keratoconus (KC)disease. PMID: 25405607
Prolactin-induced protein mediates cell invasion and regulates integrin signaling in estrogen receptor-negative breast cancer. PMID: 22817771
GCDFP-15 expression is higher in tumors with favorable prognostic features. GCDFP-15 expression is further a frequent feature of androgen receptor positive tumors and the molecular apocrine subtype. PMID: 25070172
PIP is a breast cancer-related protein that is expressed in a majority of breast tumors and has a significant function in the biology of this disease. [review] PMID: 25472539
we found that HER2 or GCDFP15 protein overexpression is a sensitive and specific tool to differentiate MA from BL in the context of ER negative tumors. PMID: 23663520
The roles of PIP in the related T47D breast cancer cell line, were investigated. PMID: 23755096
PIP is required for cell cycle progression in breast cancer and provides a rationale for exploring PIP inhibition as a therapeutic approach in breast cancer that can potentially target microtubule polymerization. PMID: 24862759
Report GCDFP15 expression in metastatic basal-like triple negative breast carcinomas. PMID: 24272937
AZGP1 and PIP were found in significantly lower levels in invasive breast tissue. PMID: 24114735
GCDFP-15 was associated significantly with a breast cancer profile of good prognosis tumors. PMID: 23332923
Gross cystic disease fluid protein-15 and mammaglobin A expression determined by immunohistochemistry is of limited utility in triple-negative breast cancer. PMID: 22963676
Interaction analysis identifies semenogelin I fragments as new binding partners of PIP in human seminal plasma PMID: 23085372
GCDFP-15 alone is not a useful marker to detect the metastasis of basaloid type breast cancers. PMID: 23011826
expression was down-regulated in azoospermia, indicating that PIP may be a plausible marker of azoospermia PMID: 22724438
The first report of native human serum albumin (HSA)-PIP complex formation in seminal plasma. PMID: 22209935
abnormal development of the prepuce in hypospadias is associated with variation in PIP expression PMID: 21883842
Data suggest that Runx2 controls a positive feedback loop between androgen signaling and PIP, and pharmacological inhibition of PIP may be useful to treat PIP positive tumors. PMID: 21809344
Most basal-like breast carcinomas and unclassified triple-negative carcinomas are negative for mammaglobin and gross cystic disease fluid protein 15. PMID: 21411781
expressed on a small subset of primary lung adenocarcinomas PMID: 19620839
Intragenic amplification and formation of extrachromosomal small circular DNA molecules from the PIP gene on chromosome 7 in primary breast carcinomas PMID: 11992405
different conformations and/or tissue-specific posttranslational modifications of the proteins, although their primary structure was identical by MS/MS analysis PMID: 12755619
Forms a protein complex with PIG-F and is involved in the conversion of phosphatidylinositol glycans. PMID: 15632136
The sensitivity of mammaglobin is equal or superior to that of GCDFP-15 for investigation of breast carcinoma. PMID: 18251583
analysis of the novel complex formed between zinc alpha2-glycoprotein (ZAG) and prolactin-inducible protein (PIP) from human seminal plasma PMID: 18930737
Both MGB1 and GCDFP-15 are specific markers for metastatic breast carcinomas in cell block fluid specimens (88 vs. 96%). PMID: 19217055
importance of a regulatory subnetwork associated with PIP expression in which STAT5 appears as a potential transcriptional regulator PMID: 19262752
PIP(alternate name GCDFP-15, gp17) is a secretory marker of apocrine differentiation in breast carcinoma. It is an aspartyl proteinase with specificity restricted for fibronectin. PMID: 10713110

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.