Recombinant Human PINCH 1 Protein
Beta LifeScience
SKU/CAT #: BLA-7026P
Recombinant Human PINCH 1 Protein
Beta LifeScience
SKU/CAT #: BLA-7026P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | P48059 |
Synonym | 2310016J22Rik 4921524A02Rik AI507642 AU021743 AW551584 C430041B13Rik LIM and senescent cell antigen like domains 1 LIM and senescent cell antigen-like-containing domain protein 1 LIM zinc finger domain containing 1 LIM-type zinc finger domains 1 Lims1 LIMS1_HUMAN Lims1l Particularly interesting new Cys His protein Particularly interesting new Cys His protein 1 Particularly interesting new Cys-His protein 1 PINCH PINCH 1 PINCH-1 PINCH1 Renal carcinoma antigen NY REN 48 Renal carcinoma antigen NY-REN-48 senescent cell antigen wu:fc32c03 zgc:112533 |
Description | Recombinant Human PINCH 1 Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLF YEFEGRKYCEHDFQMLFAPCCHQCGEFIIGRVIKAMNNSWHPECFRCDLC QEVLADIGFVKNAGRHLCRPCHNREKARGLGKYICQKCHAIIDEQPLIFK NDPYHPDHFNCANCGKELTADARELKGELYCLPCHDKMGVPICGACRRPI EGRVVNAMGKQWHVEHFVCAKCEKPFLGHRHYERKGLAYCETHYNQLFGD VCFHCNRVIEGDVVSALNKAWCVNCFACSTCNTKLTLKNKFVEFDMKPVC KKCYEKFPLELKKRLKKLAETLGRK |
Molecular Weight | 62 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |