Recombinant Human PIBF Protein
Beta LifeScience
SKU/CAT #: BLA-6999P
Recombinant Human PIBF Protein
Beta LifeScience
SKU/CAT #: BLA-6999P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Synonym | C13orf24 KIAA1008 PIBF PIBF 1 PIBF1 PIBF1_HUMAN Progesterone immunomodulatory binding factor 1 Progesterone induced blocking factor 1 Progesterone-induced-blocking factor 1 RP11 505F3.1 |
Description | Recombinant Human PIBF Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | EKSALLQTKNQMALDLEQLLNHREELAAMKQILVKMHSKHSENSLLLTKT EPKHVTENQKSKTLNVPKEHEDNIFTPKPTLFTKKEAPEWSKKQKM |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |