Recombinant Human PI3 Kinase p110 beta Protein
Beta LifeScience
SKU/CAT #: BLA-6989P
Recombinant Human PI3 Kinase p110 beta Protein
Beta LifeScience
SKU/CAT #: BLA-6989P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | 5-bisphosphate 3-kinase 110 kDa catalytic subunit beta 5-bisphosphate 3-kinase catalytic subunit beta isoform DKFZp779K1237 MGC133043 OTTHUMP00000216901 OTTHUMP00000216904 p110 BETA p110Beta Phosphatidylinositol 3 kinase catalytic beta polypeptide Phosphatidylinositol 4 5 bisphosphate 3 kinase 110 kDa catalytic subunit beta Phosphatidylinositol 4 5 bisphosphate 3 kinase catalytic subunit beta isoform Phosphatidylinositol-4 Phosphoinositide 3 kinase catalytic beta polypeptide PI3 kinase p110 subunit beta PI3-kinase subunit beta PI3K PI3K beta PI3K-beta PI3Kbeta PI3KCB PIK3C1 Pik3cb PK3CB_HUMAN PtdIns 3 kinase p110 PtdIns-3-kinase subunit beta PtdIns-3-kinase subunit p110-beta |
Description | Recombinant Human PI3 Kinase p110 beta Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | EFRRKMRKFSEEKILSLVGLSWMDWLKQTYPPEHEPSIPENLEDKLYGGK LIVAVHFENCQDVFSFQVSPNMNPIKVNELAIQKRLTIHGKEDEVSPYDY VLQVSGRVEY |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |