Recombinant Human PHPT1 Protein
Beta LifeScience
SKU/CAT #: BLA-6959P
Recombinant Human PHPT1 Protein
Beta LifeScience
SKU/CAT #: BLA-6959P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | Q9NRX4 |
Synonym | 14 kDa phosphohistidine phosphatase CGI 202 HSPC141 Phosphohistidine phosphatase 1 PHP14 PHP14_HUMAN PHPT1 Protein janus A homolog Protein janus-A homolog Sex regulated protein janus a |
Description | Recombinant Human PHPT1 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMAVADLALIPDVDIDSDGVFKYVLIRVHSA PRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRIS HQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY |
Molecular Weight | 16 kDa |
Purity | >95% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycle. |