Recombinant Human Phospholipase C gamma 1/PLC-gamma-1 Protein
Beta LifeScience
SKU/CAT #: BLA-6954P
Recombinant Human Phospholipase C gamma 1/PLC-gamma-1 Protein
Beta LifeScience
SKU/CAT #: BLA-6954P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P19174-2 |
Synonym | 1 phosphatidyl D myo inositol 4 5 bisphosphate 1 phosphatidylinositol 4 5 bisphosphate phosphodiesterase gamma 1 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1 Inositoltrisphosphohydrolase Monophosphatidylinositol phosphodiesterase NCKAP3 Phosphatidylinositol phospholipase C Phosphoinositidase C Phosphoinositide phospholipase C Phosphoinositide phospholipase C-gamma-1 Phospholipase C 148 Phospholipase C gamma 1 Phospholipase C-gamma-1 Phospholipase C-II PLC gamma 1 PLC II PLC-148 PLC-gamma-1 PLC-II PLC1 PLC148 Plcg1 PLCG1_HUMAN PLCgamma1 |
Description | Recombinant Human Phospholipase C gamma 1/PLC-gamma-1 Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | LKNNYSEDLELASLLIKIDIFPAKQENGDLSPFSGTSLRERGSDASGQLF HGRAREGSFESRYQQPFEDFRISQEHLADHFDSRERRAPRRTRVNGDNRL |
Molecular Weight | 37 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |