Recombinant Human Phospholipase C beta 1/PLCB1 Protein
Beta LifeScience
SKU/CAT #: BLA-6952P
Recombinant Human Phospholipase C beta 1/PLCB1 Protein
Beta LifeScience
SKU/CAT #: BLA-6952P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Synonym | 1 phosphatidylinositol 4,5 bisphosphate phosphodiesterase beta 1 1-phosphatidyl-D-myo-inositol-4,5-bisphosphate 1-phosphatidylinositol 4 1-phosphatidylinositol-4 5-bisphosphate phosphodiesterase beta-1 EIEE12 Inositoltrisphosphohydrolase Monophosphatidylinositol phosphodiesterase Phosphb Phosphoinositidase C Phosphoinositide phospholipase C Phosphoinositide phospholipase C-beta 1 Phosphoinositide phospholipase C-beta-1 Phospholipase C beta 1 (phosphoinositide-specific) Phospholipase C I Phospholipase C-beta-1 Phospholipase C-I PI PLC PLC 1 PLC beta 1 PLC I PLC-154 PLC-beta-1 PLC-I PLC154 Plcb Plcb1 Plcb1 protein PLCB1_HUMAN PLCbeta1 Triphosphoinositide phosphodiesterase |
Description | Recombinant Human Phospholipase C beta 1/PLCB1 Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | VQYIKRLEEAQSKRQEKLVEKHKEIRQQILDEKPKLQVELEQEYQDKFKR LPLEILEFVQEAMKGKISEDSNHGSAPLSLSSDPGKVNHKTPSSEELGGD IPGKEFDTPL |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |