Recombinant Human PHIP Protein
Beta LifeScience
SKU/CAT #: BLA-6941P
Recombinant Human PHIP Protein
Beta LifeScience
SKU/CAT #: BLA-6941P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | Q8WWQ0 |
Synonym | DCAF14 DDB1 and CUL4 associated factor 14 FLJ20705 FLJ45918 IRS 1 PH domain binding protein IRS1 PH domain binding protein MGC90216 Ndrp Neuronal differentiation related protein PH interacting protein Pleckstrin homology domain interacting protein WD repeat containing protein 11 WD repeat protein 11 WDR11 |
Description | Recombinant Human PHIP Protein was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | MHHHHHHSLIYKPLDGEWGTNPRDEECERIVAGINQLMTLDIASAFVAPV DLQAYPMYCTVVAYPTDLSTIKQRLENRFYRRVSSLMWEVRYIEHNTRTF NEPGSPIVKSAKFVTDLLLHFIKDQTCYNIIPLYNSMKKKVLSDSEDEE |
Molecular Weight | 17 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Store at -80°C. |