Recombinant Human PHF5A Protein
Beta LifeScience
SKU/CAT #: BLA-6938P
Recombinant Human PHF5A Protein
Beta LifeScience
SKU/CAT #: BLA-6938P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Synonym | 1110007B08Rik Ac2 246 bK223H9.2 INI MGC1346 OTTHUMP00000198827 PHD finger 5a PHD finger like domain containing protein 5A PHD finger like domain protein 5A PHD finger protein 5A PHD finger-like domain protein 5A PHD finger-like domain-containing protein 5A Phf5a PHF5A_HUMAN Rds3 SAP14b SF3b14b Splicing factor 3B associated 14 kDa protein Splicing factor 3B-associated 14 kDa protein Transcription factor INI |
Description | Recombinant Human PHF5A Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECN YGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFY ERKKYGFKKR |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |