Recombinant Human PGRPS Protein (BSA and azide free)
Beta LifeScience
SKU/CAT #: BLA-6923P
Recombinant Human PGRPS Protein (BSA and azide free)
Beta LifeScience
SKU/CAT #: BLA-6923P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | O75594 |
Synonym | MGC126894 MGC126896 Peptidoglycan recognition protein Peptidoglycan recognition protein 1 Peptidoglycan recognition protein short PGLYRP PGLYRP1 PGRP PGRP S PGRP-S PGRP1_HUMAN PHRP, short SBBI68 TAG7 TNF superfamily, member 3 (LTB)-like (peptidoglycan recognition protein) TNFSF 3L TNFSF3L UNQ639/PRO1269 |
Description | Recombinant Human PGRPS Protein (BSA and azide free) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | QETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPA SCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHL WNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHR DVQRTLSPGNQLYHLIQNWPHYRSP |
Molecular Weight | 21 kDa including tags |
Purity | Greater than 90% Densitometry. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at Room Temperature. Store at +4°C short term (1-2 weeks). Store at -80°C. Avoid freeze / thaw cycle. |