Recombinant Human PGGT1B Protein
Beta LifeScience
SKU/CAT #: BLA-6904P
Recombinant Human PGGT1B Protein
Beta LifeScience
SKU/CAT #: BLA-6904P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Synonym | BGGI Geranylgeranyl transferase type I subunit beta Geranylgeranyl transferase type-1 subunit beta Geranylgeranyltransferase type I beta subunit GGTase-I-beta GGTI PGGT1B PGTB1_HUMAN Protein geranylgeranyltransferase type I, beta subunit Type I protein geranyl-geranyltransferase subunit beta |
Description | Recombinant Human PGGT1B Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | MVATEDERLAGSGEGERLDFLRDRHVRFFQRCLQVLPERYSSLETSRLTI AFFALSGLDMLDSLDVVNKDDIIEWIYSLQVLPTEDRSNLNRCGFRGSSY LGIPF |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |