Recombinant Human PFDN4 Protein
Beta LifeScience
SKU/CAT #: BLA-6881P
Recombinant Human PFDN4 Protein
Beta LifeScience
SKU/CAT #: BLA-6881P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | Q9NQP4 |
Synonym | C1 PFD4 PFD4_HUMAN PFDN4 Prefoldin 4 Prefoldin subunit 4 Protein C-1 Protein C1 |
Description | Recombinant Human PFDN4 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | HHHHHHMAATMKKAAAEDVNVTFEDQQKINKFARNTSRITELKEEIEVKK KQLQNLEDACDDIMLADDDCLMIPYQIGDVFISHSQEETQEMLEEAKKNL QEEIDALESRVESIQRVLADLKVQLYAKFGSNINLEADES |
Molecular Weight | 15 kDa |
Purity | >95% SDS-PAGE.Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. Lyophilized from a 0.2 µM filtered solution. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Please see notes section. |