Recombinant Human PFD6 Protein
Beta LifeScience
SKU/CAT #: BLA-6879P
Recombinant Human PFD6 Protein
Beta LifeScience
SKU/CAT #: BLA-6879P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | O15212 |
Synonym | H2 KE2 H2KE2 HKE2 HLA class II region expressed gene KE2 KE 2 KE2 KE2 protein KE2, mouse, homolog of PFD6_HUMAN Pfdn6 Prefoldin subunit 6 Protein Ke2 |
Description | Recombinant Human PFD6 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMAELIQKKLQGEVEKYQQLQKDLSKSMSGR QKLEAQLTENNIVKEELALLDGSNVVFKLLGPVLVKQELGEARATVGKRL DYITAEIKRYESQLRDLERQSEQQRETLAQLQQEFQRAQAAKAGAPGKA |
Molecular Weight | 17 kDa including tags |
Purity | Greater than 95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |