Recombinant Human Peroxiredoxin 2/PRP Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-6862P
Recombinant Human Peroxiredoxin 2/PRP Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-6862P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | P32119 |
Synonym | Epididymis secretory sperm binding protein Li 2a HEL S 2a MGC4104 Natural killer cell enhancing factor B Natural killer cell-enhancing factor B Natural Killer Enhancing Factor B NKEF B NKEF-B NKEFB Peroxiredoxin 2 Peroxiredoxin-2 PRDX 2 PRDX2 PRDX2_HUMAN PrP PRX2 PRXII PTX1 TDPX1 Thiol Specific Antioxidant 1 Thiol specific antioxidant protein Thiol-specific antioxidant protein Thioredoxin Dependent Peroxide Reductase 1 Thioredoxin peroxidase 1 Thioredoxin-dependent peroxide reductase 1 Torin TPX1 TSA |
Description | Recombinant Human Peroxiredoxin 2/PRP Protein (His tag) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | ASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVC PTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNI PLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRS VDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN |
Molecular Weight | 22 kDa |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |