Recombinant Human Peregrin/BRPF1 Protein
Beta LifeScience
SKU/CAT #: BLA-6847P
Recombinant Human Peregrin/BRPF1 Protein
Beta LifeScience
SKU/CAT #: BLA-6847P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | NM_001003694 |
Synonym | BR140 Bromodomain and PHD finger containing 1 Bromodomain and PHD finger-containing protein 1 bromodomain-containing protein, 140kD BRPF1 BRPF1_HUMAN Peregrin Protein Br140 |
Description | Recombinant Human Peregrin/BRPF1 Protein was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | MHHHHHHMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVTELDEVPD YLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIF YRAAVRLREQGGAVLRQARRQAEKMG |
Molecular Weight | 15 kDa including tags |
Purity | >= 69% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle. |