Recombinant Human PEN2 Protein
Beta LifeScience
SKU/CAT #: BLA-6839P
Recombinant Human PEN2 Protein
Beta LifeScience
SKU/CAT #: BLA-6839P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | Q9NZ42 |
Synonym | Gamma secretase subunit PEN 2 Gamma Secretase Subunit PEN2 Gamma-secretase subunit PEN-2 Hematopoietic stem/progenitor cells protein MDS033 MDS033 MSTP064 PEN 2 PEN2_HUMAN Presenilin Enhancer 2 Presenilin enhancer 2 homolog Presenilin enhancer protein 2 PSEN2 psenen |
Description | Recombinant Human PEN2 Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQ SQIKGYVWRSAVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGT P |
Molecular Weight | 37 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |