Recombinant Human PEG10/EDR Protein
Beta LifeScience
SKU/CAT #: BLA-6835P
Recombinant Human PEG10/EDR Protein
Beta LifeScience
SKU/CAT #: BLA-6835P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | AA407948 Edr Embryonal carcinoma differentiation regulated Embryonal carcinoma differentiation-regulated protein HB 1 HB1 KIAA1051 Mammalian retrotransposon-derived protein 2 Mar2 Mart2 MEF3 like 1 MEF3-like protein 1 MEF3L MEF3L1 MyEF 3 Myelin expression factor 3-like protein 1 Paternally expressed 10 Paternally expressed gene 10 ORF1 Paternally expressed gene 10 protein Peg10 PEG10 protein PEG10_HUMAN Putative uncharacterized protein PEG10 Retrotransposon gag domain containing 3 Retrotransposon gag domain-containing protein 3 Retrotransposon-derived gag-like polyprotein Retrotransposon-derived protein PEG10 RGAG3 Ty3/Gypsy-like protein |
Description | Recombinant Human PEG10/EDR Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MTERRRDELSEEINNLREKVMKQSEENNNLQSQVQKLTEENTTLREQVEP TPEDEDDDIELRGAAAAAAPPPPIEEECPEDLPEKFDGNPDMLAPFMAQC QIFMEKSTRDFSVDRVRVCFVTSMMTGRAARWASAKLERSHYLMHNYPAF MMEMKHVFEDPQRREVAKRKIRRLRQGMGSVIDYSNAFQMIAQDLDWNEP ALIDQYHEGLSDHIQEELSHLEVAKSLSALIGQCIHIERRLARAAAARKP RSPPRALVLPHIASHHQVDPTEPVGGARMRLTQEEKERRRKLNLCLYCGT GGHYADNCPAKASKSSPAGNSPAPL |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |