Recombinant Human PEDF Protein
Beta LifeScience
SKU/CAT #: BLA-6832P
Recombinant Human PEDF Protein
Beta LifeScience
SKU/CAT #: BLA-6832P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | P36955 |
Synonym | Cell proliferation-inducing gene 35 protein EPC 1 EPC-1 EPC1 OI12 OI6 PEDF PEDF_HUMAN PIG 35 PIG35 Pigment epithelium derived factor Pigment epithelium-derived factor Proliferation inducing protein 35 Serine (or cysteine) proteinase inhibitor serine (or cysteine) proteinase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1 Serpin F1 Serpin family F member 1 Serpin peptidase inhibitor Serpin peptidase inhibitor clade F member 1 serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1 SERPINF 1 Serpinf1 |
Description | Recombinant Human PEDF Protein was expressed in HEK293. It is a Full length protein |
Source | HEK293 |
AA Sequence | QNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVR SSTSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIH GTYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVL TGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVT KFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLT GSMSIIFFLPLKVTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKLKL SYEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRAGFEWNEDGA GTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGPV DHHHHHH |
Molecular Weight | 45 kDa including tags |
Purity | >95% SDS-PAGE.Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. The lyo |