Recombinant Human PEA15 Protein
Beta LifeScience
SKU/CAT #: BLA-6829P
Recombinant Human PEA15 Protein
Beta LifeScience
SKU/CAT #: BLA-6829P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | Q15121 |
Synonym | 15 kDa phosphoprotein enriched in astrocytes Astrocytic phosphoprotein PEA 15 Astrocytic phosphoprotein PEA-15 Astrocytic phosphoprotein PEA15 HMAT 1 HMAT1 Homolog of mouse MAT 1 oncogene Homolog of mouse MAT1 oncogene HUMMAT 1H HUMMAT1H MAT 1 MAT 1H MAT1 MAT1H PEA 15 Pea15 PEA15 protein PEA15_HUMAN PED Phosphoprotein enriched in astrocytes 15 Phosphoprotein enriched in astrocytes 15kD Phosphoprotein enriched in diabetes |
Description | Recombinant Human PEA15 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | GSHMAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFS FLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDT KLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA |
Molecular Weight | 15 kDa |
Purity | Greater than 95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |