Recombinant Human PDIA6 Protein
Beta LifeScience
SKU/CAT #: BLA-6810P
Recombinant Human PDIA6 Protein
Beta LifeScience
SKU/CAT #: BLA-6810P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q15084 |
Synonym | Endoplasmic reticulum protein 5 ER protein 5 ERp5 P5 Pdia6 PDIA6_HUMAN Protein disulfide isomerase A6 Protein disulfide isomerase associated 6 Protein disulfide isomerase family A member 6 Protein disulfide isomerase P5 Protein disulfide isomerase related protein Protein disulfide-isomerase A6 Thioredoxin domain containing 7 (protein disulfide isomerase) Thioredoxin domain containing protein 7 Thioredoxin domain-containing protein 7 TXNDC7 |
Description | Recombinant Human PDIA6 Protein was expressed in HEK293. It is a Full length protein |
Source | HEK293 |
AA Sequence | LYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAA TALKDVVKVGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRT GEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRSDSSSKKDVIELTDDS FDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAA VDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLF SDNAPPPELLEIINEDIAKRTCEEHQLCVVAVLPHILDTGAAGRNSYLEV LLKLADKYKKKMWGWLWTEAGAQSELETALGIGGFGYPAMAAINARKMKF ALLKGSFSEQGINEFLRELSFGRGSTAPVGGGAFPTIVEREPWDGRDGEL PVEDDIDLSDVELDDLGKDELVDHHHHHH |
Molecular Weight | 47 kDa including tags |
Purity | Greater than 95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |