Recombinant Human PDCD6/ALG-2 Protein
Beta LifeScience
SKU/CAT #: BLA-6773P
Recombinant Human PDCD6/ALG-2 Protein
Beta LifeScience
SKU/CAT #: BLA-6773P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | O75340 |
Synonym | AIP1 ALG 2 ALG-2-interacting protein 1 ALG2 ALIX Apoptosis linked gene 2 Apoptosis linked gene 2 protein Apoptosis-linked gene 2 protein FLJ42309 FLJ46208 Hp95 KIAA1375 MA 3 MA3 MGC111017 MGC119050 MGC9123 PDCD 6 Pdcd6 PDCD6_HUMAN PEF 1B PEF1B Probable calcium binding protein ALG 2 Probable calcium binding protein ALG2 Probable calcium-binding protein ALG-2 Programmed cell death 6 Programmed cell death 6-interacting protein Programmed cell death protein 6 PS 2 PS2 |
Description | Recombinant Human PDCD6/ALG-2 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMAAYSYRPGPGAGPGPAAGAALPDQSFLWN VFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGV NFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQF HDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSY EQYLSMVFSIV |
Molecular Weight | 24 kDa including tags |
Purity | Greater than 95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycle. |