Recombinant Human PDCD4 Protein
Beta LifeScience
SKU/CAT #: BLA-6770P
Recombinant Human PDCD4 Protein
Beta LifeScience
SKU/CAT #: BLA-6770P
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | Q53EL6 |
Synonym | Death up-regulated gene protein Dug H731 Ma3 MGC33046 MGC33047 Neoplastic transformation inhibitor Neoplastic transformation inhibitor protein Nuclear antigen H731 Nuclear antigen H731 like Nuclear antigen H731 like protein Nuclear antigen H731-like PDCD 4 Pdcd4 PDCD4_HUMAN Programmed cell death 4 programmed cell death 4 (neoplastic transformation inhibitor) Programmed cell death protein 4 Protein 197/15a Protein MA-3 Tis Topoisomerase-inhibitor suppressed protein |
Description | Recombinant Human PDCD4 Protein was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | MKASHREMTSKLLSDLCGTVMSTTDVEKSFDKLLKDLPELALDTPRAPQL VGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATVLLSMSKGGKR KDSVWGSGGGQQSVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPLEH HHHHH |
Molecular Weight | 17 kDa including tags |
Purity | >95% SDS-PAGE.Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. Supplied as a 0.2 µM filtered solution. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |