Recombinant Human PDCD10/CCM3 Protein
Beta LifeScience
SKU/CAT #: BLA-6767P
Recombinant Human PDCD10/CCM3 Protein
Beta LifeScience
SKU/CAT #: BLA-6767P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | Q9BUL8 |
Synonym | Apoptosis related protein 15 CCM3 Cerebral cavernous malformations 3 protein MGC1212 MGC24477 PDC10_HUMAN PDCD 10 PDCD10 Programmed cell death 10 Programmed cell death protein 10 TF 1 cell apoptosis related protein 15 TF-1 cell apoptosis-related protein 15 TFAR15 |
Description | Recombinant Human PDCD10/CCM3 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSMRMTMEEMKNEAETTSMVSMPLYAVMYPVFN ELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLL RMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTI KDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTY FKDGKAINVFVSANRLIHQTNLILQTFKTVA |
Molecular Weight | 27 kDa including tags |
Purity | >95% SDS-PAGE.Purity is >95%, by SDS-PAGE and silver stain. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycle. |