Recombinant Human PCNP Protein
Beta LifeScience
SKU/CAT #: BLA-6733P
Recombinant Human PCNP Protein
Beta LifeScience
SKU/CAT #: BLA-6733P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q8WW12 |
Synonym | Ab2 416 AI647035 PCNP PCNP_HUMAN PEST containing nuclear protein PEST proteolytic signal containing nuclear protein PEST proteolytic signal-containing nuclear protein PEST-containing nuclear protein |
Description | Recombinant Human PCNP Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSHMADGKAGDEKPEKSQRAGAAGGPEEE AEKPVKTKTVSSSNGGESSSRSAEKRSAEEEAADLPTKPTKISKFGFAIG SQTTKKASAISIKLGSSKPKETVPTLAPKTLSVAAAFNEDEDSEPEEMPP EAKMRMKNIGRDTPTSAGPNSFNKGKHGFSDNQKLWERNIKSHLGNVHDQ DN |
Molecular Weight | 22 kDa including tags |
Purity | Greater than 95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |