Recombinant Human PCID1 Protein (Tagged)

Name: Recombinant Human PCID1 Protein (Tagged)
Brand: Beta LifeScience
SKU: BLA-6722P
Availability: InStock

Collections: Other recombinant proteins, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Human
Accession	Q7L2H7
Synonym	B5 B5 receptor Dendritic cell protein eIF3m EIF3M_HUMAN Eukaryotic translation initiation factor 3 subunit M Fetal lung protein B5 FLJ29030 GA17 hfl B5 hFL-B5 PCI domain containing 1 (herpesvirus entry mediator) PCI domain-containing protein 1 PCID1 TANGO7
Description	Recombinant Human PCID1 Protein (Tagged) was expressed in E.coli. It is a Full length protein
Source	E.coli
AA Sequence	SVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACDV CLKEDDKDVESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSL RLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKWI SDWNLTTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQAR VDAHRCIVRALKDPNAFLFDHLLTLKPVKFLEGELIHDLLTIFVSAKLAS YVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQEL QIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLY DTLNAWKQNLNKVKNSLLSLSDT
Molecular Weight	58 kDa including tags
Purity	>90% SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function	Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression.; (Microbial infection) May favor virus entry in case of infection with herpes simplex virus 1 (HSV1) or herpes simplex virus 2 (HSV2).
Subcellular Location	Cytoplasm.
Protein Families	EIF-3 subunit M family
Database References	HGNC: 24460 OMIM: 609641 KEGG: hsa:10480 STRING: 9606.ENSP00000436049 UniGene: Hs.502244
Tissue Specificity	Broadly expressed.

Gene Functions References

POLR2J interacts with three different subunits of eIF3, eIF3a, eIF3i, and eIF3m. PMID: 22022972
eIF3m mediates regulation of tumorigenesis-related genes in human colon cancer PMID: 20838379
Results demonstrate that B5 plays a major role in the initiation of HSV protein translation and could provide a novel target for strategies to prevent primary and recurrent herpetic disease. PMID: 20676407
Cloned a previously uncharacterized human gene, designated hfl-B5, and showed that it encodes a type II cell surface membrane protein that can serve as a receptor for entry of HSV. PMID: 15919898
Concluded that the C terminus of B5 contains a functional region that is important for the B5 receptor to mediate events in HSV entry. PMID: 15919899
the human Tango7 counterpart, PCID1 (also known as EIF3M), impinged on caspase 9, revealing a new regulatory axis affecting the apoptosome PMID: 19483676

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.