Recombinant Human PBK/SPK Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-6701P
Recombinant Human PBK/SPK Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-6701P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | Q96KB5 |
Synonym | Cancer/testis antigen 84 CT84 Epididymis luminal protein 164 FLJ14385 HEL164 Lymphokine activated killer T cell originated protein kinase Lymphokine-activated killer T-cell-originated protein kinase MAPKK like protein kinase MAPKK-like protein kinase Nori 3 Nori-3 Nori3 PBK PDZ binding kinase PDZ-binding kinase Serine/threonine protein kinase Spermatogenesis related protein kinase Spermatogenesis-related protein kinase SPK T LAK cell originated protein kinase T-LAK cell-originated protein kinase TOPK TOPK_HUMAN |
Description | Recombinant Human PBK/SPK Protein (Tagged) was expressed in Baculovirus infected Sf9 cells. It is a Full length protein |
Source | Baculovirus infected Sf9 cells |
AA Sequence | MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMK RSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGY RAFTEANDGSLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNM ARGLKYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTVT DPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINL SNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDESYQKVIELFSVC TNEDPKDRPSAAHIVEALETDV |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. |