Recombinant Human PAR6 Protein
Beta LifeScience
SKU/CAT #: BLA-6660P
Recombinant Human PAR6 Protein
Beta LifeScience
SKU/CAT #: BLA-6660P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | Q9NPB6-2 |
Synonym | 0710008C04Rik 2610010A15Rik Par 6 partitioning defective 6 C elegans homolog alpha Par 6 partitioning defective 6 homolog alpha Par 6 partitioning defective 6 homolog alpha C elegans PAR 6A PAR-6 PAR-6 alpha par-6 family cell polarity regulator alpha PAR-6A PAR6 PAR6A_HUMAN PAR6alpha PAR6C Pard6a Partitioning defective 6 homolog alpha partitioning-defective protein 6 partitioning-defective protein 6, C. elegans, homolog of, alpha Tax interacting protein 40 Tax interaction protein 40 TAX40 TIP 40 TIP-40 TIP40 |
Description | Recombinant Human PAR6 Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MARPQRTPARSPDSIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVH QIPGLDVLLGYTDAHGDLLPLTNDDSLHRALASGPPPLRLLVQKREADSS GLAFASNSLQRRKKGLLLRPVAPLRTRPPLLISLPQDFRQVSSVIDVDLL PETHRRVRLHKHGSDRPLGFYIRDGMSVRVAPQGLERVPGIFISRLVRGG LAESTGLLAVSDEILEVNGIEVAGKTLDQVTDMMVANSHNLIVTVKPANQ RNNVVRGASGRLTGPPSAGPGPAEPDSDDDSSDLVIENRQPPSSNGLSQG PPCWDLHPGCRHPGTRSSLPSLDDQEQASSGWGSRIRGDGSGFSL |
Molecular Weight | 64 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |