Recombinant Human PAR4 Protein
Beta LifeScience
SKU/CAT #: BLA-6659P
Recombinant Human PAR4 Protein
Beta LifeScience
SKU/CAT #: BLA-6659P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | Q96IZ0 |
Synonym | 2310001G03Rik PAR 4 PAR-4 Pawr PAWR_HUMAN PRKC Apoptosis WT1 Regulator PRKC apoptosis WT1 regulator protein Prostate apoptosis response 4 protein Prostate apoptosis response protein 4 prostate apoptosis response protein PAR-4 Transcriptional repressor Par-4-like protein PAWR Transcriptional repressor PAR4 WT1 Interacting Protein |
Description | Recombinant Human PAR4 Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | SVSEEDVSSRYSRTDRSGFPRYNRDANVSGTLVSSSTLEKKIEDLEKEVV RERQENLRLVRLMQDKEEMIGKLKEEIDLLNRDLDDIEDENEQLKQENKT LLKVVGQLTR |
Molecular Weight | 38 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |