Recombinant Human Oct4 Protein
Beta LifeScience
SKU/CAT #: BLA-0008P
Recombinant Human Oct4 Protein
Beta LifeScience
SKU/CAT #: BLA-0008P
Catalog No.: BLA-0008P
Product Overview
| Host Species | Human |
| Accession | Q01860 |
| Synonym | Octamer binding transcription factor 4 MGC22487 Oct 3 Oct 4 Oct-3 Oct-4 OCT3 Oct4 Octamer binding protein 3 Octamer binding protein 4 Octamer binding transcription factor 3 Octamer-binding protein 3 Octamer-binding protein 4 Octamer-binding transcription factor 3 OTF 3 OTF 4 OTF-3 OTF3 OTF4 PO5F1_HUMAN POU class 5 homeobox 1 POU domain class 5 transcription factor 1 POU domain transcription factor OCT4 POU domain, class 5, transcription factor 1 POU-type homeodomain-containing DNA-binding protein POU5F1 |
| Description | Recombinant Human Oct4 Protein was expressed in E.coli. It is a Full length protein |
| Source | E.coli |
| AA Sequence | MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPG VGPGSEVWGIPPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAG VGVESNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIKALQKELEQFA KLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKL RPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFL QCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEA AGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSV TTLGSPMHSNESGGGGSPGRRRRRRRRRRR |
| Molecular Weight | 41 kDa |
| Purity | >90% SDS-PAGE |
| Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
| Bioactivity | The in vitro function was tested using specific DNA binding assays. 11R proteins were reported to successfully generate induced pluripotent stem (iPS) cells from OG2 MEFs. |
| Formulation | Liquid Solution |
| Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
| Reconstitution | See related COA |
| Unit Definition | For Research Use Only |
| Storage Buffer | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycle. |
