Recombinant Human GALK1 Protein

Beta LifeScience SKU/CAT #: BLA-3691P
Recombinant Human GALK1 Protein

Recombinant Human GALK1 Protein

Beta LifeScience SKU/CAT #: BLA-3691P
Catalog No.: BLA-3691P

Product Overview

Host Species Human
Accession P51570
Synonym EC 2.7.1.6 epididymis secretory protein Li 19 Galactokinase Galactokinase 1 Galactose kinase GALK GALK 1 GALK1 GALK1_HUMAN GK1 GLK GLK1 HEL-S-19
Description Recombinant Human GALK1 Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MAALRQPQVAELLAEARRAFREEFGAEPELAVSAPGRVNLIGEHTDYNQG LVLPMALELMTVLVGSPRKDGLVSLLTTSEGADEPQRLQFPLPTAQRSLE PGTPRWANYVKGVIQYYPAAPLPGFSAVVVSSVPLGGGLSSSASLEVATY TFLQQLCPDSGTIAARAQVCQQAEHSFAGMPCGIMDQFISLMGQKGHALL IDCRSLETSLVPLSDPKLAVLITNSNVRHSLASSEYPVRRRQCEEVARAL GKESLREVQLEELEAARDLVSKEGFRRARHVVGEIRRTAQAAAALRRGDY RAFGRLMVESHRSLRDDYEVSCPELDQLVEAALAVPGVYGSRMTGGGFGG CTVTLLEASAAPHAMRHIQEHYGGTATFYLSQAADGAKVLCL
Molecular Weight 42 kDa
Purity >95% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed