Recombinant Human Fc epsilon RI/FCER1A Protein

Beta LifeScience SKU/CAT #: BLA-3827P
Recombinant Human Fc epsilon RI/FCER1A Protein

Recombinant Human Fc epsilon RI/FCER1A Protein

Beta LifeScience SKU/CAT #: BLA-3827P
Catalog No.: BLA-3827P

Product Overview

Host Species Human
Accession P12319
Synonym Fc epsilon RI alpha Fc epsilon RI alpha chain Fc epsilon RI alpha-chain Fc fragment of IgE high affinity I receptor for alpha polypeptide Fc fragment of IgE, high affinity I, receptor for, alpha subunit Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide Fc IgE receptor alpha polypeptide Fc IgE receptor, alpha chain Fc IgE receptor, alpha polypeptide Fc of IgE high affinity I receptor for alpha polypeptide Fc-epsilon RI-alpha FCE 1A FCE1A FCER 1A Fcer1a FCERA_HUMAN FcERI FceRI alpha high affinity IgE receptor High affinity immunoglobulin epsilon receptor alpha subunit high affinity immunoglobulin epsilon receptor alpha-subunit High affinity immunoglobulin epsilon receptor subunit alpha IgE Fc receptor alpha subunit IgE Fc receptor subunit alpha Immunoglobulin E receptor high affinity of mast cells alpha polypeptide immunoglobulin E receptor, high-affinity, of mast cells, alpha polypeptide
Description Recombinant Human Fc epsilon RI/FCER1A Protein was expressed in HEK293. It is a Protein fragment
Source HEK293
AA Sequence VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETN SSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEG QPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYY CTGKVWQLDYESEPLNITVIKAPREKYWLQ
Molecular Weight 22 kDa including tags
Purity >90% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity Measured by its binding ability in a functional ELISA. Immobilized Human FCER1A at 2 μg/ml (100 μl/well).The concentration of Human IgE that produces 50% of the optimal binding response is found to be approximately 0.1 - 0.4 µg/ml.
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -80°C. Reconstitute for long term storage.
Recently viewed