Recombinant Human FANCI Protein

Beta LifeScience SKU/CAT #: BLA-3488P
Recombinant Human FANCI Protein

Recombinant Human FANCI Protein

Beta LifeScience SKU/CAT #: BLA-3488P
Catalog No.: BLA-3488P

Product Overview

Host Species Human
Accession Q9NVI1
Synonym FANCI FANCI gene FANCI_HUMAN Fanconi anemia group I protein Fanconi anemia, complementation group I FLJ10719 FLJ14658 KIAA1794 Protein FACI Protein FANCI
Description Recombinant Human FANCI Protein was expressed in Wheat germ. It is a Protein fragment
Source Wheat germ
AA Sequence MFKDVPLTAEEVEFVVEKALSMFSKMNLQEIPPLVYQLLVLSSKGSRKSV LEGIIAFFSALDKQHNEEQSGDE
Molecular Weight 34 kDa including tags
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed