Recombinant Human FANCA/FAA Protein
Beta LifeScience
SKU/CAT #: BLA-3487P
Recombinant Human FANCA/FAA Protein
Beta LifeScience
SKU/CAT #: BLA-3487P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | FA FA 1 FA H FA1 FAA FACA FAH Fanca FANCA_HUMAN FANCH Fanconi anemia complementation group A Fanconi anemia complementation group H Fanconi anemia group A protein Fanconi anemia type 1 MGC75158 Protein FACA |
Description | Recombinant Human FANCA/FAA Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MSDSWVPRSASGQDPGGRRRAWAELLAGRVKREKYNPERAQKLKESAVRL LRSHQDLNALLLEVEGPLCKKLSLSKVIDCDSSEAYANHSSSFIGSALQD QASRLGVPVGILSAGMVASSVGQICTAPAETSHPVLLTVEQRKKLSSLLE FARYLLAHSMFSRLSFCQELWKIQSSLLLEAVWHLHVQGIVSLQELLESH PDMHAVGSWLFRNLCCLCEQMEASCQHADVARAMLSDFVQMFVLRGFQKN SDLRRTVEPEKMPQVAVDVLQRMLIFALDALAAGVQEESSTHKIVRC |
Molecular Weight | 58 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |