Recombinant Human FANCA/FAA Protein

Beta LifeScience SKU/CAT #: BLA-3487P
Recombinant Human FANCA/FAA Protein

Recombinant Human FANCA/FAA Protein

Beta LifeScience SKU/CAT #: BLA-3487P
Catalog No.: BLA-3487P

Product Overview

Host Species Human
Synonym FA FA 1 FA H FA1 FAA FACA FAH Fanca FANCA_HUMAN FANCH Fanconi anemia complementation group A Fanconi anemia complementation group H Fanconi anemia group A protein Fanconi anemia type 1 MGC75158 Protein FACA
Description Recombinant Human FANCA/FAA Protein was expressed in Wheat germ. It is a Full length protein
Source Wheat germ
AA Sequence MSDSWVPRSASGQDPGGRRRAWAELLAGRVKREKYNPERAQKLKESAVRL LRSHQDLNALLLEVEGPLCKKLSLSKVIDCDSSEAYANHSSSFIGSALQD QASRLGVPVGILSAGMVASSVGQICTAPAETSHPVLLTVEQRKKLSSLLE FARYLLAHSMFSRLSFCQELWKIQSSLLLEAVWHLHVQGIVSLQELLESH PDMHAVGSWLFRNLCCLCEQMEASCQHADVARAMLSDFVQMFVLRGFQKN SDLRRTVEPEKMPQVAVDVLQRMLIFALDALAAGVQEESSTHKIVRC
Molecular Weight 58 kDa including tags
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed