Recombinant Human FAM50A/XAP5 Protein

Beta LifeScience SKU/CAT #: BLA-3480P
Recombinant Human FAM50A/XAP5 Protein

Recombinant Human FAM50A/XAP5 Protein

Beta LifeScience SKU/CAT #: BLA-3480P
Catalog No.: BLA-3480P

Product Overview

Host Species Human
Accession Q14320
Synonym 9F DXS9928E FA50A_HUMAN FAM 50A fam50a Family with sequence similarity 50 member A HXC 26 HXC26 OTTHUMP00000061460 Protein FAM50A Protein HXC 26 Protein HXC-26 Protein HXC26 Protein XAP 5 Protein XAP-5 Protein XAP5 XAP 5 XAP 5 protein XAP5 XAP5 gene XAP5 protein
Description Recombinant Human FAM50A/XAP5 Protein was expressed in E.coli. It is a Protein fragment
Source E.coli
AA Sequence TTKKRKLGKNPDVDTSFLPDRDREEEENRLREELRQEWEAKQEKIKSEEI EITFSYWDGSGHRRTVKMRKGNTMQQFLQKALEILRKDFSELRSAGVEQL MYIKEDLIIPHHHSFYDFIVTKARGKSGPLFNFDVHDDVRLLSDATVEKD ESHAGKVVLRSWYEKNKHIFPASRWEPYDPEKKWDKYTIR
Molecular Weight 25 kDa including tags
Purity >90% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed