Recombinant Human FAM20C Protein (Tagged)

Beta LifeScience SKU/CAT #: BLA-3472P
Recombinant Human FAM20C Protein (Tagged)

Recombinant Human FAM20C Protein (Tagged)

Beta LifeScience SKU/CAT #: BLA-3472P
Catalog No.: BLA-3472P

Product Overview

Host Species Human
Accession Q8IXL6
Synonym C76981 Dentin matrix protein 4 DKFZp547C074 DMP-4 DMP4 DMP4_HUMAN Extracellular serine/threonine protein kinase Fam20C Fam20c Family with sequence similarity 20 member C GEF CK Golgi enriched fraction casein kinase Protein FAM20C RNS
Description Recombinant Human FAM20C Protein (Tagged) was expressed in Mammalian. It is a Full length protein
Source Mammalian
AA Sequence DFSSDPSSNLSSHSLEKLPPAAEPAERALRGRDPGALRPHDPAHRPLLRD PGPRRSESPPGPGGDASLLARLFEHPLYRVAVPPLTEEDVLFNVNSDTRL SPKAAENPDWPHAGAEGAEFLSPGEAAVDSYPNWLKFHIGINRYELYSRH NPAIEALLHDLSSQRITSVAMKSGGTQLKLIMTFQNYGQALFKPMKQTRE QETPPDFFYFSDYERHNAEIAAFHLDRILDFRRVPPVAGRMVNMTKEIRD VTRDKKLWRTFFISPANNICFYGECSYYCSTEHALCGKPDQIEGSLAAFL PDLSLAKRKTWRNPWRRSYHKRKKAEWEVDPDYCEEVKQTPPYDSSHRIL DVMDMTIFDFLMGNMDRHHYETFEKFGNETFIIHLDNGRGFGKYSHDELS ILVPLQQCCRIRKSTYLRLQLLAKEEYKLSLLMAESLRGDQVAPVLYQPH LEALDRRLRVVLKAVRDCVERNGLHSVVDDDLDTEHRAASAR
Molecular Weight 66 kDa
Purity >90% by SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed