Recombinant Human FAM171B Protein (Fc Tag)

Beta LifeScience SKU/CAT #: BLA-3468P
Recombinant Human FAM171B Protein (Fc Tag)

Recombinant Human FAM171B Protein (Fc Tag)

Beta LifeScience SKU/CAT #: BLA-3468P
Catalog No.: BLA-3468P

Product Overview

Host Species Human
Accession AAH60872
Synonym F171B_HUMAN Fam171b Family with sequence similarity 171, member B KIAA1946 Protein FAM171B
Description Recombinant Human FAM171B Protein (Fc Tag) was expressed in HEK293. It is a Protein fragment
Source HEK293
AA Sequence ELSRSDLSLIQQQQQQQQQQQQQQQQKQLEEAEEERTEVPGATSTLTVPV SVFMLKVQVNDIISRQYLSQAVVEVFVNYTKTNSTVTKSNGAVLIKVPYK LGLSLTIIAYKDGYVLTPLPWKTRRMPIYSSVTLSLFPQSQANIWLFEDT VLITGKLADAKSQPSVQFSKALIKLPDNHHISNVTGYLTVLQQFLKVDNF LHTTGITLNKPGFENIELTPLAAICVKIYSGGKELKVNGSIQVSLPLLRL NDISAGDRIPAWTFDMNTGAWINHGRGMVKEHNNHLIWTYDAPHLGYWIA APLPGTRGSGINEDSKDITAYHT
Molecular Weight 63 kDa including tags
Purity >95% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed