Recombinant Human FAM167A Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-3467P
Recombinant Human FAM167A Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-3467P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q96KS9 |
Synonym | C8orf13; D8S265 family with sequence similarity 167, member A hypothetical protein LOC83648 |
Description | Recombinant Human FAM167A Protein (Tagged) was expressed in Mammalian. It is a Full length protein |
Source | Mammalian |
AA Sequence | MSVPQIHVEEVGAEEGAGAAAPPDDHLRSLKALTEKLRLETRRPSYLEWQ ARLEEHTWPFPRPAAEPQASLEEGERGGQEPLLPLREAGQHPPSARSASQ GARPLSTGKLEGFQSIDEAIAWLRKELTEMRLQDQQLARQLMRLRGDINK LKIEHTCRLHRRMLNDATYELEERDELADLFCDSPLASSFSLSTPLKLIG VTKMNINSRRFSLC |
Molecular Weight | 24 kDa |
Purity | >90% by SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |