Recombinant Human FAM167A Protein (Tagged)

Beta LifeScience SKU/CAT #: BLA-3467P
Recombinant Human FAM167A Protein (Tagged)

Recombinant Human FAM167A Protein (Tagged)

Beta LifeScience SKU/CAT #: BLA-3467P
Catalog No.: BLA-3467P

Product Overview

Host Species Human
Accession Q96KS9
Synonym C8orf13; D8S265 family with sequence similarity 167, member A hypothetical protein LOC83648
Description Recombinant Human FAM167A Protein (Tagged) was expressed in Mammalian. It is a Full length protein
Source Mammalian
AA Sequence MSVPQIHVEEVGAEEGAGAAAPPDDHLRSLKALTEKLRLETRRPSYLEWQ ARLEEHTWPFPRPAAEPQASLEEGERGGQEPLLPLREAGQHPPSARSASQ GARPLSTGKLEGFQSIDEAIAWLRKELTEMRLQDQQLARQLMRLRGDINK LKIEHTCRLHRRMLNDATYELEERDELADLFCDSPLASSFSLSTPLKLIG VTKMNINSRRFSLC
Molecular Weight 24 kDa
Purity >90% by SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed