Recombinant Human Factor VIII Protein

Beta LifeScience SKU/CAT #: BLA-3447P
Recombinant Human Factor VIII Protein

Recombinant Human Factor VIII Protein

Beta LifeScience SKU/CAT #: BLA-3447P
Catalog No.: BLA-3447P

Product Overview

Host Species Human
Accession P00451-2
Synonym AHF Antihemophilic factor Coagulation factor VIII coagulation factor VIII, procoagulant component coagulation factor VIIIc DXS1253E F8 F8b F8c FA8_HUMAN factor VIII F8B Factor VIIIa light chain FactorVIII FVIII Hema Hemophilia A Hemophilia, classic OTTHUMP00000061446 OTTHUMP00000196174 Procoagulant component
Description Recombinant Human Factor VIII Protein was expressed in Wheat germ. It is a Full length protein
Source Wheat germ
AA Sequence MRIQDPGKVFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMEL MGCDLNSCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRS NAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQ DGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQ IALRMEVLGCEAQDLY
Molecular Weight 51 kDa including tags
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed