Recombinant Human Factor B Protein

Beta LifeScience SKU/CAT #: BLA-3437P
Recombinant Human Factor B Protein

Recombinant Human Factor B Protein

Beta LifeScience SKU/CAT #: BLA-3437P
Catalog No.: BLA-3437P

Product Overview

Host Species Human
Accession P00751
Synonym AHUS4 B factor properdin BF BFD C3 proaccelerator C3 proactivator C3/C5 convertase CFAB CFAB_HUMAN CFB Complement Factor B Complement factor B Bb fragment FB FBI12 GBG Glycine rich beta glycoprotein Glycine-rich beta glycoprotein H2 Bf H2BF PBF2 Properdin factor B
Description Recombinant Human Factor B Protein was expressed in HEK293. It is a Full length protein
Source HEK293
AA Sequence TPWSLAWPQGSCSLEGVEIKGGSFRLLQEGQALEYVCPSGFYPYPVQTRT CRSTGSWSTLKTQDQKTVRKAECRAIHCPRPHDFENGEYWPRSPYYNVSD EISFHCYDGYTLRGSANRTCQVNGRWSGQTAICDNGAGYCSNPGIPIGTR KVGSQYRLEDSVTYHCSRGLTLRGSQRRTCQEGGSWSGTEPSCQDSFMYD TPQEVAEAFLSSLTETIEGVDAEDGHGPGEQQKRKIVLDPSGSMNIYLVL DGSDSIGASNFTGAKKCLVNLIEKVASYGVKPRYGLVTYATYPKIWVKVS EADSSNADWVTKQLNEINYEDHKLKSGTNTKKALQAVYSMMSWPDDVPPE GWNRTRHVIILMTDGLHNMGGDPITVIDEIRDLLYIGKDRKNPREDYLDV YVFGVGPLVNQVNINALASKKDNEQHVFKVKDMENLEDVFYQMIDESQSL SLCGMVWEHRKGTDYHKQPWQAKISVIRPSKGHESCMGAVVSEYFVLTAA HCFTVDDKEHSIKVSVGGEKRDLEIEVVLFHPNYNINGKKEAGIPEFYDY DVALIKLKNKLKYGQTIRPICLPCTEGTTRALRLPPTTTCQQQKEELLPA QDIKALFVSEEEKKLTRKEVYIKNGDKKGSCERDAQYAPGYDKVKDISEV VTPRFLCTGGVSPYADPNTCRGDSGGPLIVHKRSRFIQVGVISWGVVDVC KNQKRQKQVPAHARDFHINLFQVLPWLKEKLQDEDLGFLVDHHHHHH
Molecular Weight 84 kDa including tags
Purity >95% SDS-PAGE.Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on Dry Ice. Store at 4°C (up to 6 months). Store at -20°C.
Recently viewed