Recombinant Human FABP-1 Protein

Name: Recombinant Human FABP-1 Protein
Brand: Beta LifeScience
SKU: BLA-3425P
Availability: InStock

Collections: Other recombinant proteins, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Human
Accession	P00505
Synonym	AATM_HUMAN AL022787 Aspartate aminotransferase Aspartate aminotransferase 2 Aspartate aminotransferase, mitochondrial Aspartate transaminase 2 ASPATA EC 2.6.1.1 FABP 1 FABP pm FABP-1 FABPpm Fatty acid binding protein Fatty acid-binding protein FLJ40994 Glutamate oxaloacetate transaminase 2 Glutamate oxaloacetate transaminase 2, mitochondrial Glutamate oxaloacetate transaminase, mitochondrial Glutamic oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2) Got 2 GOT2 KAT4 KATIV kynurenine aminotransferase 4 Kynurenine aminotransferase IV kynurenine--oxoglutarate transaminase 4 kynurenine--oxoglutarate transaminase IV mAspAT MGC102129 MGC115763 mitAAT mitochondrial Mitochondrial aspartate aminotransferase OTTMUSP00000017748 Plasma membrane fatty acid binding protein Plasma membrane-associated fatty acid-binding protein Transaminase A
Description	Recombinant Human FABP-1 Protein was expressed in E.coli. It is a Full length protein
Source	E.coli
AA Sequence	MGSSHHHHHHSSGLVPRGSHMGSSSWWTHVEMGPPDPILGVTEAFKRDTN SKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFC KASAELALGENSEVLKSGRFVTVQTISGTGALRIGASFLQRFFKFSRDVF LPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEDISKIPEQSV LLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDGDK DAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVES QLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKVMADRIIGMRT QLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDG RISVAGVTSSNVGYLAHAIHQVTK
Molecular Weight	47 kDa including tags
Purity	>95% purity as determined by SDS-PAGE
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity	Specific activity is > 60 units/mg, and is defined as theamount of enzyme that convert 1μmole of -ketoglutarate to L-Glutamate perminute at pH 8.0 at 25°C.
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function	Catalyzes the irreversible transamination of the L-tryptophan metabolite L-kynurenine to form kynurenic acid (KA). As a member of the malate-aspartate shuttle, it has a key role in the intracellular NAD(H) redox balance. Is important for metabolite exchange between mitochondria and cytosol, and for amino acid metabolism. Facilitates cellular uptake of long-chain free fatty acids.
Subcellular Location	Mitochondrion matrix. Cell membrane.
Protein Families	Class-I pyridoxal-phosphate-dependent aminotransferase family
Database References	HGNC: 4433 OMIM: 138150 KEGG: hsa:2806 STRING: 9606.ENSP00000245206 UniGene: Hs.599470

Gene Functions References

Study utilizing integrative analysis of transcriptomic, metabolomic, and clinical data propose a model of GOT2 transcriptional regulation, in which the cooperative phosphorylation of STAT3 and direct joint binding of STAT3 and p65/NF-kappaB to the proximal GOT2 promoter are important. Furthermore, high aberrant GOT2 expression is prognostic in diffuse large B-cell lymphoma. PMID: 29666362
The results of our study on this larger than 5800-patient cohort suggest beneficial effects of high B12 vitamin level, negative effects of high sodium levels or high AST (aspartate aminotransferase) liver enzyme levels to cognition. PMID: 28918286
Like in adults, FABP seems to be associated with markers of metabolic risk in obese adolescents PMID: 28183455
Data suggest that, in context of abnormal hepatic lipid accumulation in nonalcoholic fatty liver disease, circulating GOT2 rises due to up-regulation of hepatic expression of GOT2 associated with greater gluconeogenesis and insulin resistance. PMID: 26791191
A previously unknown mechanism by which GOT2 acetylation stimulates the malate-aspartate NADH shuttle activity and oxidative protection. PMID: 25755250
High glucose infusion was associated with increased expression of higher plasma membrane-associated fatty acid-binding protein (FABPpm). PMID: 24937540
The lipid binding process in L-FABP is associated with backbone dynamics. PMID: 22713574
Frequency of polymorphism are similar in control groups and schizophrenics. PMID: 17728674

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.