Recombinant Human FABP-1 Protein

Beta LifeScience SKU/CAT #: BLA-3425P
Recombinant Human FABP-1 Protein

Recombinant Human FABP-1 Protein

Beta LifeScience SKU/CAT #: BLA-3425P
Catalog No.: BLA-3425P

Product Overview

Host Species Human
Accession P00505
Synonym AATM_HUMAN AL022787 Aspartate aminotransferase Aspartate aminotransferase 2 Aspartate aminotransferase, mitochondrial Aspartate transaminase 2 ASPATA EC 2.6.1.1 FABP 1 FABP pm FABP-1 FABPpm Fatty acid binding protein Fatty acid-binding protein FLJ40994 Glutamate oxaloacetate transaminase 2 Glutamate oxaloacetate transaminase 2, mitochondrial Glutamate oxaloacetate transaminase, mitochondrial Glutamic oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2) Got 2 GOT2 KAT4 KATIV kynurenine aminotransferase 4 Kynurenine aminotransferase IV kynurenine--oxoglutarate transaminase 4 kynurenine--oxoglutarate transaminase IV mAspAT MGC102129 MGC115763 mitAAT mitochondrial Mitochondrial aspartate aminotransferase OTTMUSP00000017748 Plasma membrane fatty acid binding protein Plasma membrane-associated fatty acid-binding protein Transaminase A
Description Recombinant Human FABP-1 Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MGSSHHHHHHSSGLVPRGSHMGSSSWWTHVEMGPPDPILGVTEAFKRDTN SKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFC KASAELALGENSEVLKSGRFVTVQTISGTGALRIGASFLQRFFKFSRDVF LPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEDISKIPEQSV LLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDGDK DAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVES QLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKVMADRIIGMRT QLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDG RISVAGVTSSNVGYLAHAIHQVTK
Molecular Weight 47 kDa including tags
Purity >95% purity as determined by SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity Specific activity is > 60 units/mg, and is defined as theamount of enzyme that convert 1μmole of -ketoglutarate to L-Glutamate perminute at pH 8.0 at 25°C.
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed